PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G01105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NZZ/SPL
Protein Properties Length: 318aa    MW: 34997 Da    PI: 9.104
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G01105genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE2431.4e-7413181314
      NOZZLE   1 matslffms.tdqnsvrnpnellrntrlvvnssgeirte.tkksrgrkpgskt.aqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaais 96 
                 matslff+s td n  +n      n + + +++  irt  ++k+rgrkpgsk+  qq+qkkp  rgmgva+ler++i+ee+k     t+ +      i+
  AA32G01105   1 MATSLFFISsTDHNNNNNTSLSTPNDHHLPSNTDLIRTTePQKTRGRKPGSKSvPQQNQKKPRRRGMGVAQLERQRIQEEHKLTSLDTNPNPN---QIP 96 
                 9******963788877776666667766655556688644************7369*************************988888888777...555 PP

      NOZZLE  97 n.tatrlpvpvdrgvvlqgfps....slgssrilcgg...vgsgqvmidpvis.....pwgfvetsatthelssis..npqmynassnnrcdtcfkkkr 180
                 n +  rlp   d+ +vlqgfps       + r++ gg   vg gqv+idpv+s      wgfvets+   elssi+  np + n s      t fkkkr
  AA32G01105  97 NpNPNRLP---DPLLVLQGFPSyqktNAVCRRYYSGGgsvVGPGQVIIDPVCSqdqttKWGFVETST---ELSSIPknNPHILNPSH-----TYFKKKR 184
                 53678***...***********655433448999998677899*********9444445*******9...*****855788888764.....67***** PP

      NOZZLE 181 ldgdqnnvvrsn......gggfskytmipppmng.ydeyllqs..dhhqrsqgflydqriaraasvsaasasinpyfneatnltgsreefgsvlegnpr 270
                 +dgd    +rs       gggfskytmipp  ng yd+  l+s   + qr  g++yd+r+ar++           +fn +t         g +++gnp 
  AA32G01105 185 FDGDV---IRSHggcggvGGGFSKYTMIPPMNNGcYDH--LPSvfGQDQRCLGMYYDHRVARSTLA---P---TGFFNHTTGSM------GDYVKGNPS 266
                 ***96...7775222222579********999995676..444124679**************922...2...35899876544......445556665 PP

      NOZZLE 271 ngsrg......vkeyeffpgkydervskvakvaslvgdcspn..tidlslkl 314
                 n  +g      vkeyeffpgky+++ +k  +  s+ gdcs n  +idlslkl
  AA32G01105 267 NEGGGagglhmVKEYEFFPGKYENFPGKYGDNISSEGDCSLNtsSIDLSLKL 318
                 533222224449******************************667*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087445.9E-703318IPR014855Plant transcription factor NOZZLE
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MATSLFFISS TDHNNNNNTS LSTPNDHHLP SNTDLIRTTE PQKTRGRKPG SKSVPQQNQK  60
KPRRRGMGVA QLERQRIQEE HKLTSLDTNP NPNQIPNPNP NRLPDPLLVL QGFPSYQKTN  120
AVCRRYYSGG GSVVGPGQVI IDPVCSQDQT TKWGFVETST ELSSIPKNNP HILNPSHTYF  180
KKKRFDGDVI RSHGGCGGVG GGFSKYTMIP PMNNGCYDHL PSVFGQDQRC LGMYYDHRVA  240
RSTLAPTGFF NHTTGSMGDY VKGNPSNEGG GAGGLHMVKE YEFFPGKYEN FPGKYGDNIS  300
SEGDCSLNTS SIDLSLKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013671376.12e-66PREDICTED: uncharacterized protein LOC106375906
SwissprotO818362e-67SPL_ARATH; Protein SPOROCYTELESS
STRINGBra026359.1-P3e-65(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134351828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27330.19e-51sporocyteless (SPL)